PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G475305_P01
Common NameLOC103649534, Zm.141343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family Nin-like
Protein Properties Length: 916aa    MW: 100992 Da    PI: 6.4303
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G475305_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.1e-29570621152
             RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                        aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  GRMZM2G475305_P01 570 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 621
                        589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.632560641IPR003035RWP-RK domain
PfamPF020423.2E-26573621IPR003035RWP-RK domain
SuperFamilySSF542771.31E-20812907No hitNo description
Gene3DG3DSA:3.10.20.2403.6E-25822903No hitNo description
SMARTSM006661.8E-24822904IPR000270PB1 domain
PROSITE profilePS5174518.534822904IPR000270PB1 domain
PfamPF005641.5E-15823902IPR000270PB1 domain
CDDcd064076.49E-33823903No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0006310anatomytassel floret
PO:0006339anatomyjuvenile vascular leaf
PO:0006340anatomyadult vascular leaf
PO:0006341anatomyprimary shoot system
PO:0006505anatomycentral spike of ear inflorescence
PO:0008018anatomytransition vascular leaf
PO:0009001anatomyfruit
PO:0009025anatomyvascular leaf
PO:0009066anatomyanther
PO:0020040anatomyleaf base
PO:0020104anatomyleaf sheath
PO:0020126anatomytassel inflorescence
PO:0020142anatomystem internode
PO:0020148anatomyshoot apical meristem
PO:0025287anatomyseedling coleoptile
PO:0001007developmental stagepollen development stage
PO:0001052developmental stagevascular leaf expansion stage
PO:0001053developmental stagevascular leaf post-expansion stage
PO:0001083developmental stageinflorescence development stage
PO:0001094developmental stageplant embryo coleoptilar stage
PO:0001180developmental stageplant proembryo stage
PO:0007001developmental stageearly whole plant fruit ripening stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
PO:0007016developmental stagewhole plant flowering stage
PO:0007032developmental stagewhole plant fruit formation stage up to 10%
PO:0007045developmental stagecoleoptile emergence stage
PO:0007063developmental stageLP.07 seven leaves visible stage
PO:0007065developmental stageLP.05 five leaves visible stage
PO:0007072developmental stageLP.18 eighteen leaves visible stage
PO:0007094developmental stageLP.01 one leaf visible stage
PO:0007101developmental stageLP.09 nine leaves visible stage
PO:0007104developmental stageLP.15 fifteen leaves visible stage
PO:0007106developmental stageLP.03 three leaves visible stage
PO:0007116developmental stageLP.11 eleven leaves visible stage
PO:0007633developmental stageendosperm development stage
PO:0021004developmental stageinflorescence initiation stage
Sequence ? help Back to Top
Protein Sequence    Length: 916 aa     Download sequence    Send to blast
MDLDPAYPPS ACADAWPFDS LTTSLLFSPQ LTPIPANSSF SWLTPHSPLW LFEDRHLLPL  60
DAPAVFEEVQ RPRSGNSHTS SKPAEQISHR WQFHLSLDED GTDNSSLFKE KLTHALRYFK  120
ESTDQHLLVQ VWAPVKNGDR YVLTTSGQPF VLDHQSIGLL QYRAVSMTYM FSVDAENVGD  180
LGLPGRVYKQ KVPEWTPNVQ YYSSGEYQRL NHAISYNVHG TVALPVFDPS AHSCIAVVEL  240
IMTSKKINYA CEVDKVCKAL EAVNLKSTEI HDHPNVQICN EGRQAALVEI LEILTVVCEE  300
HKLPLAQTWV PCKYRSVLAH GGGLKKSCLS FDGSCMGEVC MSTSDVAFHV IDAHMWGFRD  360
ACVEHHLQRG QGVPGKAFIS HKPCFSKDIR KFCKLAYPLV HYARMFGLAG CFAICLQSSY  420
TGNDDYILEF FLPPDCSDED DQNALLESVL TLMKRCLRSL KVVGDRDLSG VSLHLSNVLK  480
LENEEFKTDA QFDNSDGSLC QSPNGDRHGG SHEFDGGNKK VLDVPEGQLL TDDFSQGNGT  540
SAGRPNGSGA SDSSVLHKTN KPPERKRGKA EKTISLEVLQ QYFSGSLKNA AKSLGVCPTT  600
MKRICRQHGI SRWPSRKINK VNRSLSKLKQ VIESVQGSDA AFNLTSITGP LPIPVGPSLD  660
SLNVEKLTQS KVAELSNIAV DGDRDSLQKS LGNDGHFGIV MPQQGSTDHN NDTQLEADKA  720
SHSRSSSGEG SINSRTSEGS CQRSPANQTF VCKPIASTFA EPQLNPEEFN KEPFQEPQLP  780
LSRMLIEDSG SSKDLKNLFT STSDQPFLAP PNNLVPMKHS GSVTIKASFK EDIVRFRFSC  840
SGSVIVLKEE VAKRLRMDVG TFDIKYLDDD HEWVKLTCNS DLEECMEISR LSGSHVIRLS  900
VSDIATHFGS SCGSSG
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G475305
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G475305_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0112860.0DQ011286.1 Zea mays Mu killer (Muk) insertion site, genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008673472.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLA0A096TZQ90.0A0A096TZQ9_MAIZE; Uncharacterized protein
STRINGGRMZM2G475305_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein